Predict
Bastion4 is an ensemble classifier based on six machine learning models, each of which consists of individual models trained with various types of selected features. By feeding one or multiple protein sequences as the input to the online webserver and selecting a set of models for making the prediction, users are allowed to freely combine any individual models to customize an ensemble predictor.
An example of amino acid sequences in the FASTA format is presented, while a set of models will be used as the default setting at this webpage.
Enter a sequence

Examples
Click here for input format instructions help
Enter query protein or nucleotide sequences into the text area. Accepted input:
  • sequences in FASTA format (recommended)
  • raw sequences (two sequences are given as an example, which are separated by a newline character):
    • MLPKDKREQHFMSIPQPEMRGTGGREPIFNIPGVVIALIGLCVAVYVYQNYILSERQDFEFMMNFALIPARFSMASGFVDPAVIFTFISYSFMHGSFAHIAVNMIWLAAFGSPLAGRIGAVRMILFWVFTSVVAGLTHYALHPESLSPLVGASGAISGMMGAAARYGFRRVGYGRRSEFAGPVLPIGLTLTLKPVLIFVGVWFLINIVTGLYSTGGADFSSIAWEAHIGGFIAGFFGIPLMDRPRSYDAVLRR MHIMPPEIANTMSTQPASTRIAPSILSADFARLGEEVRNVVAAGADWIHFDVMDNHYVPNLTIGPMVCAAIRPHVQVPIDVHLMVEPVDEIVPQFAKAGANVITFHPEASRHVDRTLALIRDHGCKAGLVFNPATPLHYMDYVMDKLDVVLLMSVNPGFGGQAFIPATLAKLRDARARIDRWRAAGGQPILLEVDGGVKVDNIAEIRAAGADTFVAGSAIFGKPDYAQVIGQLRAEIARGETIAV

Please select models: help
It should be noted that:
  • In general, selecting only local-sequence-encoding based models enables high-speed predictions but at the expense of a reduced prediction accuracy.
  • In contrast, global sequence-encoding or structural-descriptor-encoding based models can provide an improved predictive performance, but suffer from increased computational complexity and time consumption.
Users are advised to be aware of the compromise between computational efficiency and prediction accuracy when selecting models.
Local Sequence Encoding Based Models:
Global Sequence Encoding Based Models:
Sequence functional Encoding Based Models:
Please choose a machine learning method you want to use in Bastion4 :


If you find our work useful for your research work, please cite: